<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
con29 con29 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 68
2 AZT+DDI 38
3 3TC+AZT 69
4 3TC+D4T+NFV 54

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y K219R     K122E, I135T, D177E, G196E, T200A  
>con29| codons 37-225
ICTELEKEGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIEQHRAKIEELRQHLWRWGFYT
PDRKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, H69K  
>con29| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004