<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C2220 C2220 Ethiopia 1986 HIV1 C PBMC MC

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, L63I, H69K, L89M, I93L, C95R  
>C2220| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIIIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGRTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      Y318F V35T, E36A, T39E, K43Q, K49R, K122E, D123G, I135T, A158P, T165P, K166Q, K173A, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, P294T, Q334N, G335D, Y339F, I341F, Y354F, R356K, M357R, R358G, G359T, E370A, A371V, T377L, K390R, E404D, V435A, A437V, L452I, V466I, D471E, H483Q, L491S, Q507L, L517I, S519N, K527S, K530R, A534S, A554S Q174P, K201P
>C2220| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEQEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPPIFQSSMPQILEPFRAPNPEIVI
YQYMDDLYVGSDLEIGQHRAPIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVFYDPSKDLIAEIQKQGNDQWTFQFYQEPFKNLKTGKFAKRGTA
HTNDVKQLTAVVQKIALESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGVETFYVDGAANRETKIGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIILAQPDKSESEIVNQIIEQLISKERVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24N, D25E, L28I, S39C, M50I, D55N, K111R, T112V, T124N, T125A, K136Q, D167E, K188R, V201I, T206S, K215N, T218L, L234I, D278A A33P, S283G
>C2220| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMANEFNIPPVVPKEIVACCDKCQLKGEAIHGQVNCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVRVIHTDNGSN
FTSNAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRRGGIGGYSAGERIIDIIASDIQTKELQNQILKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGADCVAGRQDED

References
Author Title Citation
Salminen, MO Full-length sequence of an Ethiopian human immunodeficiency virus type 1 (HIV-1) isolate of genetic subtype C. ARHR, 1996