<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
con20 con20 Brazil 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT 135
2 AZT+ DDI 79
3 AZT+ 3TC+ RTV 68

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37K, R41N, H69K, L89M  
>con20| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F       T69N, K104N, D121H, K122E, I135T, D177E, T200A, I202V, Q207E, F214L K219P, K220E
>con20| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKNSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKVEELREHLLRWGLF
TPDPEHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004