<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs160 cs160 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 118
2 AZT+DDI 65
3 3TC+AZT 8
4 3TC+AZT+RTV 163

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, K20R, M36I, I62V, L63P, A71V  
>cs160| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y D67E, V75M, F77L     T39A, E44D, S68G, V118I, D123E, I135T, E138A, I142T, Q197L, R211K  
>cs160| codons 36-225
EICAELEKDGKISKIGPENPYNTPVFAIKKKEGTKWRKLMDLRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSTNNATPGTRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGLHRTKIEELRQHLWKWGFY
TPDKKHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004