<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs128 cs128 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 23
2 AZT+ DDI 130
3 AZT+ 3TC+ NFV 99

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     K49R, I135V, S162C, E169D, K173A, Q174K, I178L, T200A, R211A  
>cs128| codons 36-225
EICTEMEKEGKISRIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILDPFRAKNPDLVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLAWGFF
TPDQKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, L63P, C95S  
>cs128| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGSTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004