<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs127 cs127 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 26
2 3TC+AZT+DDI+RTV 1
3 3TC+AZT+RTV 148

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y A62V     S48T, K49R, K122E, D123E, I135T, I178M  
>cs127| codons 36-225
EICTEMEKEGKITRIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFY
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82L   K14R, I62V, L63H, C95S  
>cs127| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVHIEICGHKAIGTVLVGPTPLNIIGRNLLTQIGSTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004