<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs195 cs195 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 57
2 AZT+ 3TC 79
3 D4T+ 3TC+ NFV 128

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I L33F, N88D I15V, K20I, R57K, D60E, L63P  
>cs195| codons 1-99
PQITLWQRPLVTIKVGGQLIEALLDTGADNTVFEEMNLPGRWKPKIIGGIGGFIKVKQYE
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     I135T, D177E, G196E, F214L  
>cs195| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGLT
TPDQKHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004