Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| BREPM211 | BREPM211 | Brazil | 2000 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | IDV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, V82T, I84V | L10I, E35D, N37D, R57RK, I62V, L63P, C67F, A71T, I72M, I93L, C95F |
| >BREPM211| codons 6-99 WQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVKQYDQVPIE IFGHKTMGTVLVGPTPTNVIGRNLLTQLGFTLNF |
References
| Author | Title | Citation |
| de Sa Filho, DJ | Analysis of the protease sequences of HIV-1 infected individuals after indinavir monotherapy. | J Clin Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
