<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM068 BREPM068 Brazil 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T L10F, L24I I15V, K20R, E35D, M36I, N37E, K55R, L63P, A71V  
>BREPM068| codons 1-99
PQITLWQRPFVTIKVGGQLREALIDTGADDTVLEDIELPGRWKPKLIGGIGGFVRVRQYD
QIPIEICGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
de Sa Filho, DJ Analysis of the protease sequences of HIV-1 infected individuals after indinavir monotherapy. J Clin Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005