<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BREPM020 BREPM020 Brazil 2000 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L89M  
>BREPM020| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVKQYD
NILIEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
de Sa Filho, DJ Analysis of the protease sequences of HIV-1 infected individuals after indinavir monotherapy. J Clin Virol, 2003