<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CP1303 CP1303 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 DDI+ D4T+ EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, T215F V75T, K219Q L100I, K103N   V111I, I135T, Q151X, T165I, D177DN, G196E, I202V, F214L, D218DE, H221HY, Q222X, L228H  
>CP1303| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDIGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPXGWKGSP
AIFQSSMIKILEPFRKQNPNIVIYQYMDDLYVGSDLEIEQHRTKVEELRQHLLRWGLFTP
EQKYXKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I W6X, L10I, K20KR, R41K, L63P, K70R, A71V, V77VI  
>CP1303| codons 4-99
TLXQRPIVTIKIGGQLREALIDTGADDTVLEEMNLPGKWKPKLIGGIGGFVKVRQYDQIP
IEICGHRVIGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Clevenbergh, P Long-term virological outcome in patients infected with multi-nucleoside analogue-resistant HIV-1. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005