<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CP0303 CP0303 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI|NVP NA
2 3TC+AZT+SQV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_SSG, L210W, T215Y A62AV Y181YC A98G E40EK, K43E, K101KR, V118VI, K122KE, I135X, S162C, D177E, V179VI, M184X, T200A, R211K, L228H, Q242QK  
>CP0303| codons 38-247
CTKLEEEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLRKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIIICQYXDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVKPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, G48GV, V82VA, L90LM   L10LI, M36I, N37E  
>CP0303| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEIELPGRWKPKLIVGIGGFIKVRQYDQIL
IEICGHKAIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Clevenbergh, P Long-term virological outcome in patients infected with multi-nucleoside analogue-resistant HIV-1. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005