<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CP1201 CP1201 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 3TC+ D4T+ EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   E35D, M36I, N37S, R41K, I62IV, L63P, I64V, I93L  
>CP1201| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVRQYDQVP
VEICGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F77L, F116Y G190S   S68G, T69N, K101Q, I202V, R206RK, F214L  
>CP1201| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDGNKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVSSDLEIGQHRTKVEELKQHLLRWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Clevenbergh, P Long-term virological outcome in patients infected with multi-nucleoside analogue-resistant HIV-1. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005