<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CP0720 CP0720 France 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP NA
2 3TC+ABC+AZT+NFV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, Q151M, M184V F77FL, F116Y, K219Q Y181C A98G, V108VI T39A, K43Q, D67X, T69N, K101X, D123E, S134SG, S162Y, D177E, V179I, T200X, E203ED, Q207QH, D218E D113DN
>CP0720| codons 38-247
CAEMEQEGKISKIGPENPYNTPVFAIKKKXSNRWRKLVDLRELNKRTQDFWEVQLGIPHP
GGLXKKKSVTILDVGNAYYSVPLDKEFRKYTAFTIPGINNETPGIRYQYNVLPMGWKGSP
AIFQYSMTKILEPFRKQNPEIIICQYVDDLYVGSDLEIGQHRXKIDELRHHLLRWGFTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   W6L, L10LV, K20M, M36V, K55R, R57K, I62V, L63P, H69K, A71I, I93M, C95F  
>CP0720| codons 4-99
TLLQRPVVTIKIGGQLMEALLDTGADDTVLEEVNLPGRWKPKIIGGIGGFVRVKQYDQVP
IEICGKKIIGTVLVGPTPANIIGRNLMTQMGFTLNF

References
Author Title Citation
Clevenbergh, P Long-term virological outcome in patients infected with multi-nucleoside analogue-resistant HIV-1. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005