<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
N57 N57 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, I15V, L19I, E35D, M36I, N37D, R57K, D60E, Q61D, L63I, K70R, I72E, V82I, L89M  
>N57| codons 1-99
PQITLWQRPLVKIKVGGQIKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVKQYE
DIIIEICGHRAEGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K49R, V106I, I142T, S162C, E169D, K173T, Q174K, I178L, Q207A, R211K P52S
>N57| codons 36-223
EICTEMEKEGKISRIGSENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSITVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKG
SPAIFQCSMTKILDPFRTKNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGFT
TPDKKHQK

References
Author Title Citation
Machado, ES Overview of genotypic and clinical profiles of human immunodeficiency virus type 1-infected children in Rio de Janeiro, Brazil. An Acad Bras Cienc, 2004