<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CS257 CS257 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 71
2 3TC+AZT 74

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V       D121A, K122E, I135V, S162C, K173T, Q174K, D177E, I178L, T200A, Q207E, R211K, F214L  
>CS257| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLAEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILEPFRTKNPELVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLT
TPDKKHQKEP

References
Author Title Citation
Machado, ES Overview of genotypic and clinical profiles of human immunodeficiency virus type 1-infected children in Rio de Janeiro, Brazil. An Acad Bras Cienc, 2004