<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CS183 CS183 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 104
2 3TC+AZT+NFV 11
3 3TC+AZT 8
4 3TC+AZT+EFV 51

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103N, V106M   T69N, I135T, S162C, F171Y, I178L, T200A  
>CS183| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKNKSMTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILEPYRKQNPDLVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFF
TPDQKHQKEP

References
Author Title Citation
Machado, ES Overview of genotypic and clinical profiles of human immunodeficiency virus type 1-infected children in Rio de Janeiro, Brazil. An Acad Bras Cienc, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005