<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
N36 N36 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, K14R, I15V, G16E, E35D, M36I, R41K, R57K, Q61N, E65D, I72T, L89M  
>N36| codons 1-99
PQITLWQRPVVTIRVEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIDICGHKATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Machado, ES Overview of genotypic and clinical profiles of human immunodeficiency virus type 1-infected children in Rio de Janeiro, Brazil. An Acad Bras Cienc, 2004