<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat14 14csf_Post Italy 1998 HIV1 B CSF None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ D4T+ SQV NA
2 None NA
3 D4T+ RTV+ SQV 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  I47IL L10I, I13V, G16E, L33V, E35D, N37T, R57K, I62V, L63T, I64V C67Q
>14csf_Post| codons 1-99
PQITLWQRPIVTVKIEGQLKEALLDTGADDTVVEDMTLPGRWKPKMLGGIGGFIKVKQYD
QVTVEIQGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, R83K, D123E, R211K  
>14csf_Post| codons 1-234
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEL

References
Author Title Citation
Cinque, P Effect of genotypic resistance on the virological response to highly active antiretroviral therapy in cerebrospinal fluid. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005