<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat6 6pla_BL Italy 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ D4T+ RTV NA
2 3TC+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75I     V35M, R83K, V90I, K122E, V179VA, V189VI, R211K  
>6pla_BL| codons 1-231
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLIDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIAI
YQYMDDLYIGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMG

References
Author Title Citation
Cinque, P Effect of genotypic resistance on the virological response to highly active antiretroviral therapy in cerebrospinal fluid. ARHR, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005