<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1435 CA5026 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 20
2 AZT+D4T 29
3 3TC+D4T 12
4 3TC+AZT+D4T+IDV 28
5 DDC+RTV+SQV 29
6 AZT+DDI+NFV 28
7 ABC+EFV+RTV+SQV 22
8 3TC+ABC+EFV+NFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M   L10V, T12S, L19Q, M36ML, N37S, I62V, L63P, A71V  
>CA5026| codons 1-99
PQITLWQRPVVSIKIGGQQKEALLDTGADDTILEELSLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, M184V, T215F K219Q K101E, Y181C, G190S   V35K, V60I, K104N, V118I, K122E, I135T, S162D, F214L, A272P  
>CA5025| codons 1-285
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKNSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
CQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005