<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP_GR52 AP_GR52 Greece 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ NFV+ SQV NA
2 AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, K122E, D123S, I135T, T165I, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S  
>AP_GR52| codons 41-244
MEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIF
QSSMIKILEPFRSKNPEIIIYQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKK
HQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Papa, A HIV-1 subtypes and circulating recombinant forms (CRFs) in Northern Greece. Virus Res, 2002