<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AP_GR50 AP_GR50 Greece 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ NFV NA
2 AZT+ IDV+ RTV+ SQV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y       K43E, V60I, R83K, V118I, S162A, G196E, E203ED, Q207E, R211K  
>AP_GR50| codons 41-244
LEEEGKISKIGPENPYNTPIFAIKKKDSTKWRKIVDFRELNKKTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIDELREHLWKWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Papa, A HIV-1 subtypes and circulating recombinant forms (CRFs) in Northern Greece. Virus Res, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005