<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA
2 EFV+ TDF+ AZT+ 3TC 17
3 LPV+ TDF+ AZT+ 3TC 4
4 LPV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46MI, I47A   T12S, I13V, I15V, L19I, Q61N  
>PNT_pat1| codons 1-99
PQITLWQRPLVSVKVGGQIKEALLDTGADDTILEEMNLPGRWKPKIAGGIGGFIKVRQYD
NILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Friend, J Isolated lopinavir resistance after virological rebound of a ritonavir/lopinavir-based regimen. AIDS, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005