<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-71 TC-71 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 52
2 3TC+ AZT+ IDV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A   L10I, I15V, L19I, K20R, E35D, M36I, R41K, L63V, H69K, A71V, T74S, L89M, I93L  
>TC-71| codons 1-99
PQITLWQRPIVTIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIVGIGGFTKVRQYD
QIVIEICGKKVIGSVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M, M184V A62V, F116Y     V8I, V35T, T39E, V60I, S68R, W88S, K101Q, K122E, D123S, I135T, E138A, K173T, Q174K, V179I, T200A, Q207E, R211K, F214L, V245Q, E248D  
>TC-71| codons 1-260
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPI
FVIKRKDRTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLQKKKSVTVLDVGDAYYSVPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRTKNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKL

References
Author Title Citation
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003