<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-62 TC-62 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ DDI+ D4T 17
2 AZT+ 3TC+ EFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   G190A   P4S, V21I, V35T, E36A, T39E, S48T, W88C, K101R, K122E, E138A, K173I, Q174K, D177G, T200A, Q207E, R211K, V245Q, E248D F214P
>TC-62| codons 1-271
PISSIETVPVKLKPGMDGPKIKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPGIVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLKWGPTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19I, M36I, R41K, D60E, Q61E, H69K, L89M, I93L  
>TC-62| codons 1-99
PQITLWQRPLVSIKIGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYE
EILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003