<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-60 TC-60 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ DDI 26
2 IDV+ ABC+ EFV 78

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   K101E, V106M V108VI V35T, T39A, S48T, K122P, D123S, K166R, K173T, Q174K, D177E, I178L, Q207E, F214L, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V  
>TC-60| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKITKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTILDVGDAYFSVPL
DPSFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82A   I15V, E35D, M36I, R41K, L63P, H69K, A71AT, I93L  
>TC-60| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKTIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003