<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-59 TC-59 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 25
2 3TC+ APV+ AZT 26
3 APV+ EFV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   P14Q, K20R, V35T, E36A, T39E, K122E, D123S, I135M, S162C, K173V, Q174KR, D177E, Y188X, T200A, Q207K, R211K, V241I, V245Q, A272S  
>TC-59| codons 1-280
PISPIETVPVKLKQGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRVKNPEIVI
YQYMDDLXVGSDLEIGQHRAKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
IQPIQLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLC

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, V82VI, L89M, I93L  
>TC-59| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003