<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TC-57 TC-57 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NVP 64

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, K122E, S163T, T165I, K173T, Q174QK, D177E, T200A, I202V, Q207E, R211K, K238R, V245Q  
>TC-57| codons 1-263
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMIKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIQLPEKDSWTVNDIQKLVGK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, Q18X, L19I, M36I, R41K, D60E, H69K, L89M, I93L  
>TC-57| codons 10-99
LVSIKVGGXIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEQILIEICGK
KAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003