<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-10 TCDD-10 Zimbabwe 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ EFV 173

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12S, G17D, L19I, M36L, N37S, D60E, L63T, H69K, L89M, I93L  
>TCDD-10| codons 1-99
PQITLWQRPIVSIKIGDQIKEALLDTGADDTVLEELSLPGRWKPKMIGGIGGFIKVRQYE
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   E6K, V35T, T39E, K122E, I135V, K173T, D177E, I178M, T200A, Q207K, R211K, V245Q, A272P, K277R, L283I, E291D, V292I, I293V  
>TCDD-10| codons 1-319
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002