<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1870 CA5000 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+DDI+NFV+SQV 17
3 3TC+DDI+NVP+RTV+SQV 13
4 3TC+NFV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74V, M184V T215V, K219Q L100I, K103N   T39A, K102R, V118I, K122E, K166R, E204Q, Q207E, R211K, F214L, A272P, K277R, L283I, I293V  
>CA5000| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKRNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEQLREHLLKWGLVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L10V, E35D, N37E, L63P, I64V, I93L  
>CA5001| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001