<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDM_Pat23 MDM23post U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+NFV+RTV+SQV NA
2 3TC+APV+AZT 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L33F, G73T L10I, I13V, K14R, R41K, I62V, L63P, I66IL, C67CF, V77I, I93L  
>MDM23post| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVFEEMNLPGKWKPKIIGGIGGFMKVRQYD
QVPIELFGHKAITTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Murphy, MD HIV protease mutations associated with amprenavir resistance during salvage therapy: importance of I54M. J Clin Virol, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005