Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MDM_Pat23 | MDM23post | U.S. | 2002 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | IDV+NFV+RTV+SQV | NA |
| 2 | 3TC+APV+AZT | 52 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54M, I84V, L90M | L33F, G73T | L10I, I13V, K14R, R41K, I62V, L63P, I66IL, C67CF, V77I, I93L |
| >MDM23post| codons 1-99 PQITLWQRPIVTVRIGGQLKEALLDTGADDTVFEEMNLPGKWKPKIIGGIGGFMKVRQYD QVPIELFGHKAITTVLIGPTPVNVIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Murphy, MD | HIV protease mutations associated with amprenavir resistance during salvage therapy: importance of I54M. | J Clin Virol, 2004 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
