<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDM_Pat23 MDM23prev U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+NFV+RTV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10LI, K14KR, R41RK, I62V, L63P, I66L, V77I, I93L  
>MDM23prev| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QVPIELCGHKAITTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Murphy, MD HIV protease mutations associated with amprenavir resistance during salvage therapy: Importance of I54M. J Clin Virol, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005