<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDM_Pat22 MDM22post U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+NFV+RTV NA
2 3TC+APV+D4T 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L10F, V11I K20I, E35D, M36I, R41K, I62V, L63P, A71I, I85V, I93L  
>MDM22post| codons 1-99
PQITLWQRPFITIKIGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFMKVRQYD
QVPIEICGHKIIGTVLVGPTPVNVVGRNLMTQLGCTLNF

References
Author Title Citation
Murphy, MD HIV protease mutations associated with amprenavir resistance during salvage therapy: Importance of I54M. J Clin Virol, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005