<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDM_Pat20 MDM20prev U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+NFV+RTV+SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A   M36I, N37D, L63P, A71V  
>MDM20prev| codons 5-92
LWQRPLVTIKIGGQLKEALLDTGADDTILEEIDLPGRWKPKIIGGIGGFIKVRQYDQIPI
EICGHKVIGTVLVGPTPANIIGRNLLTQ

References
Author Title Citation
Murphy, MD HIV protease mutations associated with amprenavir resistance during salvage therapy: importance of I54M. J Clin Virol, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005