<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MDM_Pat19 MDM19post U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+NFV NA
2 APV+D4T+DLV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, L90M   T12S, K20I, E35D, M36I, I62V, L63P, A71AV, I72L  
>MDM19post| codons 1-99
PQITLWQRPLVSIKIGGQLIEALLDTGADDTVLEDINLPGRWKPKLIGGIGGFMKVRQYD
QVPIEICGHKVLGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Murphy, MD HIV protease mutations associated with amprenavir resistance during salvage therapy: Importance of I54M. J Clin Virol, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005