<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1866 CA4994 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 64
2 AZT+DDC 17
3 AZT 34
4 AZT+IDV 17
5 IDV+DDI 39
6 3TC+D4T+NVP 58

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y A62V, V75I, K219R V106A, G190A F227L K43N, E44D, W88C, V118I, K122E, I142IV, G196E, Q207E  
>CA4994| codons 1-260
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENDGKISKIGPENPYNTPV
FVIKKKNSTKWRKLIDFRELNKRTQDFCEVQLGIPHPAGLKKKKSATVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIEQHRTKIEELREHLWRWGFYTPDRKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   R57K, L63P, A71V, I72E, V77I, I93L  
>CA4995| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKVEGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009