<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
38009 380090 Europe 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E44G, K104KN, D123E, I135L, I142L, S162C, S163C, D177E, I178M, G196E, L210F V111L
>380090| codons 35-240
VEICTEMEKGGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKKNSVTVLDLGDAYFSVPLDKEFRKYTAFTIPSLNNETPGLRYQYNVLPQGWK
GSPAIFQCCMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLFRWGF
TTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Kaye, S Observations of HIV-1 genotypic drug resistance in a trial of four reverse transcriptase inhibitors (Quattro Trial). Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005