<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
36023 3602332 Europe 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 3TC 8
3 aAPA 8
4 DDC 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V90VI, A98S, K102Q, S162A, R211K  
>3602332| codons 50-240
IGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKQKKSVTVL
DVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILE
PFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLW
MGYELHPDKWT

References
Author Title Citation
Kaye, S Observations of HIV-1 genotypic drug resistance in a trial of four reverse transcriptase inhibitors (Quattro Trial). Antivir Ther, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005