<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
225_692 225_692 Uganda 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I I13V, G16E, K20R, E35D, M36I, R41K, L63V, G68E, H69K, K70R, L89M, T91V, I93L  
>225_692| codons 1-99
PQITLWQRPLITVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICEKRAIGTVLVGPTPVNIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39R, D121Y, K122E, I142V, D177E, Q207E, R211K, T286A, E291D, I293V, P294S, E297K, A304E, E312D  
>225_692| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVSLTKEAE
LELEENREILKDPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Eshleman, SH Performance of the Celera Diagnostics ViroSeq HIV-1 genotyping system for sequence-based analysis of diverse human immunodeficiency virus type 1 strains. J Clin Microbiol, 2004