<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML013 13_2_1997 Kenya 1997 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, E35D, M36I, R41K, K45R, R57K, H69K, L89M  
>13_2_1997| codons 1-99
PQITLWQRPVVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11E, V35T, V60I, D121H, K122E, D123S, I135T, K173A, Q174K, D177E, V179I, T200A, Q207A, R211S, D250E, S251H, T286A, E291D, V292I, I293V, P294T, E312D, G335D, M357K, G359S, K366R, T369A, A371V, I375V, A376V, T377M, A400T, T403M, E404D, E432D, V435M, D471E, Q480H, H483Y, L491S, S519N, Q524K, K527G, E529D, A534S, A554S, V559I T253A
>13_2_1997| codons 1-560
PISPIETVPVELKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKEHWAVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLAEVVQKVVMESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIMGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKIL

References
Author Title Citation
Fang, G Long-term survivors in Nairobi: Complete HIV-1 RNA sequences and immunogenetic associations. J Infect Dis, 2004