<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1847 CA4954 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 78
2 AZT+DDI 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, T215F K219Q     A33AG, V60I, K103R, V118I, K122E, I135T, K166T, E194EA, I202IT, H208HY, F214L, D218DE I159L
>CA4954| codons 1-219
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKGLVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPALFQSSMTTILEPFRKQNPDIVI
YQYMDDLYVGSDLAIGQHRTKTEELRQYLLRWGLFTPEQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, I62V, L63P, I64V, H69Y  
>CA4955| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009