<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5013 TK5013a Denmark 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 14
2 3TC+ AZT+ IDV 11
3 3TC+ IDV+ D4T 95
4 3TC+ D4T+ NFV 220

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46MI, I54IV, V82VA L24LI L10LI, I15IV, K20KR, E35D, M36I, N37DE, R41K, D60DE, I62V, L63P, I64IV, E65ED, C67CY, T74TS  
>TK5013a| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADNTVLEDIDLPGKWKPKIIGGIGGFVKVRQYE
QVPVDIYGHKAIGSVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y     A98G V35I, E44D, S48E, V60I, V118VI, D121H, K122E, D177E, T200IL, I202IV, Q207E, R211K, V245K, A272P, K281KR, L282C, T286A, I293V, D324E  
>TK5013a| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKIEKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKVEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRCLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005