<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5013 TK5013 Denmark 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 14
2 3TC+ AZT+ IDV 11
3 3TC+ IDV+ D4T 95
4 3TC+ D4T+ NFV 135

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, T69D, K70KR, M184V, L210LW K219KQ K103KT A98AG V35I, E44ED, I47IL, S48X, V60I, D121H, K122E, I135IT, D177E, T200I, Q207E, R211K, T215X, V245K, D250DE, S251SI, I257IL, A272PS, K281KR, L282C, T286A, I293V  
>TK5013| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKLXKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKTKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLWKWGFXTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKEIWTVNDLQKLVGKLNWASQIYPGIKVKQLCRCLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46MI, I54IV, V82VA L24LI L10LI, I15IV, K20KR, E35D, M36I, N37DE, R41K, D60DE, Q61QH, I62V, L63LP, I64V, C67CY, H69HY  
>TK5013| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADNTVLEDIDLPGKWKPKIIGGIGGFVKVRQYE
HVPVEIYGYKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005