<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5012 TK5012b Denmark 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 64
2 ABC+ DDI+ EFV+ LPV 127

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN   K11T, V21IL, A33AV, V35T, T39A, K101X, S162SG, K173A, Q174K, D177E, V179I, Y188X, V189VI, T200TA, I202V, Q207A, R211K, V245Q, T286A, E291D, I293V, P294T, E312D  
>TK5012b| codons 1-334
PISPIETVPVTLKPGMDGPKIKQWPLTEEKIKVLTEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLXKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRAKNPEIII
YQYMDDLXIGSDLEIGQHRAKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10IV, I13V, K14KR, G16E, K20R, E35D, M36I, R41K, L63T, H69K, L89M  
>TK5012b| codons 1-99
PQITLWQRPIVTVRIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005