<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5010 TK5010 Denmark 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ RTV 5
2 3TC+ AZT+ IDV 22
3 3TC+ AZT+ NVP 228

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19I, M36I, N37D, R57K, L63S, H69K, L89M  
>TK5010| codons 1-99
PQITLWQRPLVTVKVGGQIKEALLDTGADDTVLEEIDLPGRWKPKMIGGIGGFIKVKQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V K219Q K103N K238T V35T, E36A, T39E, E40D, K43R, T69N, A98S, K102R, K122E, D123S, I135T, A158S, K173AT, D177E, E194D, T200A, Q207N, F214L, L228R, V245Q, K249Q, A272P, T286TA, E291D, V292I, I293V K30KI
>TK5010| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEIIKALTAICEDMEREGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKRNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLDIGQHRAKIEELRNHLLRWGLTTPDQKHQKEPPFRWMGYELHPDTWT
VQPIQLPEQDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005