<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
K5009 TK5009 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV+ RTV 96

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, V82A L10LF T12S, I15V, L19I, K20KR, M36I, R41K, I62V, L63P, H69K, L89M, I93L  
>TK5009| codons 1-99
PQITLWQRPFVSIKVGGQIREALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGKKAIGTVVVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36A, T39E, S48T, D121H, K122E, I142T, T165L, K173T, Q174K, D177E, G196GR, T200A, Q207E, V245K, A272S, K277R, E291D, V292I, I293V, E297K, P313T, V317A, S322A  
>TK5009| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMLKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIRQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTDIVPLTKEAE
LELAENREILKETVHGAYYDPAKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005