<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5007 TK5007 Denmark 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 97
2 3TC+ AZT+ IDV+ RTV 164

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  G73ST L10I, T12S, I15V, L19I, E35D, M36I, N37S, R41K, K45R, I62V, L63P, H69K, I85V, I93L  
>TK5007| codons 1-99
PQITLWQRPIVSIKVGGQIKEALLDTGADDTVLEDISLPGKWKPRMIGGIGGFIKVRQYD
QVPIEICGKKAISTVLVGPTPVNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     A98G T7P, V35T, T39E, S48T, K64R, K122E, D123S, I135T, K173A, D177E, T200A, Q207N, R211K, V245Q, A272P, K275R, K277R, Q278N, R284RK, T286A, E291D, V292I, I293V, P294T, E297D, L301X  
>TK5007| codons 1-309
PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRNLCKLLKGAKALTDIVTLTDEAE
FELAENREI

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005