<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5006 TK5006a Denmark 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 18
2 3TC+ AZT+ RTV+ SQV 4
3 3TC+ AZT+ NVP 98
4 D4T+ DDI+ NFV 79
5 D4T+ 3TC+ LPV 75

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA, L90LM Q58E L10LI, R41K, L63AS, I64V, H69HY, I72IV, I85IV  
>TK5006a| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVREYD
QIAVEICGYKAVGTVLVGPTPANIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V   K103KN   V35T, T39E, V60I, D121H, K122E, I135T, D177E, I178M, Y181X, T200TA, Q207E, T215X, V245E, D250E, A272P, T286A, I293V, P294T, E297A, L301X T296TP
>TK5006a| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
XQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFXTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVTLPAEAE
XELAENREILKEPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005