<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TK5005 TK5005a Denmark 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 21
2 D4T+ DDC+ IDV 64
3 3TC+ AZT+ RTV+ SQV 8
4 ABC+ NFV+ NVP 4
5 None 1
6 3TC+ AZT+ NFV 14
7 3TC+ AZT 44
8 3TC+ AZT+ IDV+ RTV 8
9 3TC+ AZT+ SQV 28
10 3TC+ AZT+ EFV 27
11 3TC+ NFV+ SQV 2
12 None 27
13 LPV 31
14 None 15
15 3TC+ D4T+ EFV+ IDV 16

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, L90M   L10I, I13V, K14R, G17D, K20R, E34N, E35D, M36I, R41K, R57K, D60E, I62V, L63P, H69K, A71IV, L89I, I93IM  
>TK5005a| codons 1-99
PQITLWQRPIVTVRIGDQLREALLDTGADDTVLNDINLPGKWKPKMIVGIGGFTKVKQYE
QVPIEICGKKIIGTVLVGPTPVNIIGRNIMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184LV, T215F F116FY, K219Q Y188L, G190A   P4PS, E6D, T27S, V35IT, V60I, V118VI, K122E, D123S, I135T, Q151X, K173S, Q174K, D177E, T200A, I202V, Q207A, R211S, L228X, V245K, D250E, A272G, T286A, I293V, P294T, E312N  
>TK5005a| codons 1-324
PISSIDTVPVKLKPGMDGPKVKQWPLSEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPXGWKGSPAIFQSSMTKILEPFRSKNPEIVI
YQYLDDLLVASDLEIGQHRAKVEELRAHLLSWGFFTPDQKHQKEPPFXWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKNPVHGVYYDPSKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005